Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-1 (TVAL1)

This Recombinant Human T cell receptor alpha variable 12-1 (TVAL1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-1 TRAV12-1

UniProt

A0A0B4J245

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC4A7 Rabbit Polyclonal Antibody
TA367265 100 µL

SLC4A7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS716210 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human ZNF365 activation kit by CRISPRa
GA107888 1 Kit

Human ZNF365 activation kit by CRISPRa

Sign In for Pricing
View Details
Human C1orf33 (MRTO4) activation kit by CRISPRa
GA109610 1 Kit

Human C1orf33 (MRTO4) activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene C4 PHB
HB12516013.100G 100 g

Polystyrene C4 PHB

Sign In for Pricing
View Details
SAMD13 (NM_001010971) Human Recombinant Protein
TP320928M 100 µg

SAMD13 (NM_001010971) Human Recombinant Protein

Sign In for Pricing
View Details