Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-1 (TVAL1)

This Recombinant Human T cell receptor alpha variable 12-1 (TVAL1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-1 TRAV12-1

UniProt

A0A0B4J245

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADGRG3 Protein (N-His, Human)
P500304 100 µg

ADGRG3 Protein (N-His, Human)

Sign In for Pricing
View Details
C12orf48 CRISPR Activation Plasmid (h)
sc-408897-ACT 20 µg

C12orf48 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
11-hydroxy-sugiol 10mM * 1mL in DMSO
A14623-10mM-D 10 mM x 1mL in DMSO

11-hydroxy-sugiol 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Mouse Celf6 Pre-designed siRNA Set B
SI102334B 1 Each

Mouse Celf6 Pre-designed siRNA Set B

Sign In for Pricing
View Details
IGF2BP3 (G-9) P
sc-376067 P 100 µg - 0.5 mL

IGF2BP3 (G-9) P

Sign In for Pricing
View Details
Rat Cysteine and histidine rich protein 1 (CYHR1) ELISA Kit
GTR10326165 96 Well

Rat Cysteine and histidine rich protein 1 (CYHR1) ELISA Kit

Sign In for Pricing
View Details