Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-1 (TVA11)

This Recombinant Human T cell receptor alpha variable 1-1 (TVA11) spans the amino acid sequence from region 19-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-1 TRAV1-1

UniProt

A0A0B4J248

Expression Region

19-108

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chondrogenic Differentiation Medium for Rat Bone Marrow Mesenchymal Stem Cells
abx705194-01 100 mL

Chondrogenic Differentiation Medium for Rat Bone Marrow Mesenchymal Stem Cells

Sign In for Pricing
View Details
Chondrogenic Differentiation Medium for Rat Bone Marrow Mesenchymal Stem Cells
abx705194-02 200 mL

Chondrogenic Differentiation Medium for Rat Bone Marrow Mesenchymal Stem Cells

Sign In for Pricing
View Details
Anti-CD11c antibody
MO11CPP5.5(V25) 25 µg

Anti-CD11c antibody

Sign In for Pricing
View Details
APPL1 Antibody
MBS8588214-01 0.1 mg

APPL1 Antibody

Sign In for Pricing
View Details
APPL1 Antibody
MBS8588214-02 0.1 mL (AF405L)

APPL1 Antibody

Sign In for Pricing
View Details
APPL1 Antibody
MBS8588214-03 0.1 mL (AF405S)

APPL1 Antibody

Sign In for Pricing
View Details