Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-1 (TVA11)

This Recombinant Human T cell receptor alpha variable 1-1 (TVA11) spans the amino acid sequence from region 19-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-1 TRAV1-1

UniProt

A0A0B4J248

Expression Region

19-108

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttc9 3'UTR Luciferase Stable Cell Line
TU222620 1.0 mL

Ttc9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DL-Carnitine HCl
C16751-10mM/1mL 10 mM/1mL

DL-Carnitine HCl

Sign In for Pricing
View Details
Apolipoprotein D (APOD) (NM_001647) Human Over-expression Lysate
LS000347-100ug 100 µg

Apolipoprotein D (APOD) (NM_001647) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse anti-HSP70 Antibody
MBS4512888-01 0.05 mL

Mouse anti-HSP70 Antibody

Sign In for Pricing
View Details
Mouse anti-HSP70 Antibody
MBS4512888-02 0.1 mL

Mouse anti-HSP70 Antibody

Sign In for Pricing
View Details
Mouse anti-HSP70 Antibody
MBS4512888-03 5x 0.1 mL

Mouse anti-HSP70 Antibody

Sign In for Pricing
View Details