Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-1 (TVA11)

This Recombinant Human T cell receptor alpha variable 1-1 (TVA11) spans the amino acid sequence from region 19-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-1 TRAV1-1

UniProt

A0A0B4J248

Expression Region

19-108

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUT2 (NM_001097638) Human Tagged ORF Clone
RG215830 10 µg

FUT2 (NM_001097638) Human Tagged ORF Clone

Sign In for Pricing
View Details
SGK1 AAV Vector (Rat) (CMV)
43627106 1 µg

SGK1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
TXNRD3 Recombinant Protein (Mouse)
RP182465 100 µg

TXNRD3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
CD86 Human
32-13122-5 5 µg

CD86 Human

Sign In for Pricing
View Details
C1orf194 CRISPR/Cas9 KO Plasmid (h)
sc-410285 20 µg

C1orf194 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
CD19 Rabbit Polyclonal Antibody
orb665906-01 30 µL

CD19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details