Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5)

This Recombinant Human T cell receptor alpha variable 5 (TVA5) spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Pancreas
CR561598 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB512360 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
HEATR5A Human Gene Knockout Kit (CRISPR)
KN420498 1 Kit

HEATR5A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nkx2.5 (NKX2-5) (NM_004387) Human Over-expression Lysate
LC401397 20 µg

Nkx2.5 (NKX2-5) (NM_004387) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse IgG + IgM (min.x Hu., Bov., Eq.),  10nm
GAF-444-10 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse IgG + IgM (min.x Hu., Bov., Eq.), 10nm

Sign In for Pricing
View Details
TAS2R38 (NM_176817) Human Over-expression Lysate
LC403589 20 µg

TAS2R38 (NM_176817) Human Over-expression Lysate

Sign In for Pricing
View Details