Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5)

This Recombinant Human T cell receptor alpha variable 5 (TVA5) spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Toll Like Receptor 4 (TLR4) ELISA Kit
RK02399 96 Tests

Human Toll Like Receptor 4 (TLR4) ELISA Kit

Sign In for Pricing
View Details
CYB5D2 Human siRNA Oligo Duplex (Locus ID 124936)
SR325678 1 Kit

CYB5D2 Human siRNA Oligo Duplex (Locus ID 124936)

Sign In for Pricing
View Details
5-Benzyloxygramine
MBS3616630-01 100 mg

5-Benzyloxygramine

Sign In for Pricing
View Details
5-Benzyloxygramine
MBS3616630-02 5x 100 mg

5-Benzyloxygramine

Sign In for Pricing
View Details
SYNJ1 (Synaptojanin-1, Synaptic inositol 1,5-trisphosphate 5-Phosphatase 1, SYNJ1, KIAA0910)
302781 200 µL

SYNJ1 (Synaptojanin-1, Synaptic inositol 1,5-trisphosphate 5-Phosphatase 1, SYNJ1, KIAA0910)

Sign In for Pricing
View Details
VSIG8 Antibody Blocking peptide
orb1458874 500 µg

VSIG8 Antibody Blocking peptide

Sign In for Pricing
View Details