Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 39 (TVA39)

This Recombinant Human T cell receptor alpha variable 39 (TVA39) spans the amino acid sequence from region 19-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 39 TRAV39

UniProt

A0A0B4J263

Expression Region

19-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ELKVEQNPLFLSMQEGKNYTIYCNYSTTSDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSTLHITAAVHDLSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (MUC5AC/917), CF568 conjugate, 0.1mg/mL
BNC680917-100 1x 100 µL

Mucin 5AC (MUC5AC) (MUC5AC/917), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) Rabbit Polyclonal Antibody
AP20468PU-N 100 µg

14-3-3 zeta (YWHAZ) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF647 conjugate, 0.1mg/mL
BNC471561-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IGSF5 (N-term) Rabbit Polyclonal Antibody
AP52176PU-N 400 µL

IGSF5 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pdcd1lg2 Mouse Gene Knockout Kit (CRISPR)
KN312993 1 Kit

Pdcd1lg2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARL4 (ARL4A) (NM_212460) Human Over-expression Lysate
LC431002 20 µg

ARL4 (ARL4A) (NM_212460) Human Over-expression Lysate

Sign In for Pricing
View Details