Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 39 (TVA39)

This Recombinant Human T cell receptor alpha variable 39 (TVA39) spans the amino acid sequence from region 19-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 39 TRAV39

UniProt

A0A0B4J263

Expression Region

19-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ELKVEQNPLFLSMQEGKNYTIYCNYSTTSDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSTLHITAAVHDLSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5T4 Rabbit mAb
orb1925035 100 µg

5T4 Rabbit mAb

Sign In for Pricing
View Details
FGF19 Antibody
orb1178325 100 µg

FGF19 Antibody

Sign In for Pricing
View Details
Adipocyte plasma membrane-associated protein
orb1644260-01 50 µg

Adipocyte plasma membrane-associated protein

Sign In for Pricing
View Details
Adipocyte plasma membrane-associated protein
orb1644260-02 100 µg

Adipocyte plasma membrane-associated protein

Sign In for Pricing
View Details
Adipocyte plasma membrane-associated protein
orb1644260-03 1 mg

Adipocyte plasma membrane-associated protein

Sign In for Pricing
View Details
Rat Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4 (NOX4) ELISA Kit
RDR-NOX4-Ra-48Tests 48 Tests

Rat Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4 (NOX4) ELISA Kit

Sign In for Pricing
View Details