Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-1 (TV381)

This Recombinant Human T cell receptor alpha variable 38-1 (TV381) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-1 TRAV38-1

UniProt

A0A0B4J264

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSENNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Dog IgG (H&L) - Cy5.5
BS22159-01 100 µL

Rabbit Anti-Dog IgG (H&L) - Cy5.5

Sign In for Pricing
View Details
Rabbit Anti-Dog IgG (H&L) - Cy5.5
BS22159-02 500 µL

Rabbit Anti-Dog IgG (H&L) - Cy5.5

Sign In for Pricing
View Details
Human Muscarinic acetylcholine receptor M3 (CHRM3) ELISA Kit
AE61438HU-01 48 Tests

Human Muscarinic acetylcholine receptor M3 (CHRM3) ELISA Kit

Sign In for Pricing
View Details
Human Muscarinic acetylcholine receptor M3 (CHRM3) ELISA Kit
AE61438HU-02 96 Tests

Human Muscarinic acetylcholine receptor M3 (CHRM3) ELISA Kit

Sign In for Pricing
View Details
UBE3C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2575908 1.0 µg DNA

UBE3C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal CD28 Antibody [Alexa Fluor 488]
NB100-93558AF488 0.1 mL

Rabbit Polyclonal CD28 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details