Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-1 (TV381)

This Recombinant Human T cell receptor alpha variable 38-1 (TV381) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-1 TRAV38-1

UniProt

A0A0B4J264

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSENNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nupr1 (NM_019738) Mouse Tagged ORF Clone Lentiviral Particle
MR200140L3V 200 µL

Nupr1 (NM_019738) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
EphA3 Receptor (Ephrin A3 Receptor) (MaxLight 490)
E3365-02-ML490 100 µL

EphA3 Receptor (Ephrin A3 Receptor) (MaxLight 490)

Sign In for Pricing
View Details
FREM1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV650708 1.0 µg DNA

FREM1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Mouse Tmco6 ELISA KIT
ELI-51689m 96 Tests

Mouse Tmco6 ELISA KIT

Sign In for Pricing
View Details
Rabbit Polyclonal Avian Influenza A H5N1 Neuraminidase Antibody [Janelia Fluor 646]
NBP2-41048JF646 0.1 mL

Rabbit Polyclonal Avian Influenza A H5N1 Neuraminidase Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
FBXL14 Antibody
orb1264273 400 μl

FBXL14 Antibody

Sign In for Pricing
View Details