Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 24 (TVA24)

This Recombinant Human T cell receptor alpha variable 24 (TVA24) spans the amino acid sequence from region 23-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 24 TRAV24

UniProt

A0A0B4J272

Expression Region

23-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-6His)
PKSQ050121-01 10 µg

Recombinant Rhesus Macaque Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-6His)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-6His)
PKSQ050121-02 50 µg

Recombinant Rhesus Macaque Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-6His)

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF647 conjugate, 0.1mg/mL
BNC470597-500 1x 500 µL

Alkaline Phosphatase (ALPL/597), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hist1h2ail1 (pThr11) Mouse Monoclonal Antibody [Clone ID: N123/48]
75-224 100 µL

Hist1h2ail1 (pThr11) Mouse Monoclonal Antibody [Clone ID: N123/48]

Sign In for Pricing
View Details
BNP (NPPB) Human Gene Knockout Kit (CRISPR)
KN206590RB 1 Kit

BNP (NPPB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Xrcc3 Mouse Gene Knockout Kit (CRISPR)
KN519522 1 Kit

Xrcc3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details