Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 24 (TVA24)

This Recombinant Human T cell receptor alpha variable 24 (TVA24) spans the amino acid sequence from region 23-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 24 TRAV24

UniProt

A0A0B4J272

Expression Region

23-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL2 Human Gene Knockout Kit (CRISPR)
KN400501 1 Kit

ARL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Optional dimpled mat for use with a variety of tubes
B3D5000-DIMP 1 Each

Optional dimpled mat for use with a variety of tubes

Sign In for Pricing
View Details
Recombinant FGF19 Antibody
RC-16176-01 50 μL

Recombinant FGF19 Antibody

Sign In for Pricing
View Details
Recombinant FGF19 Antibody
RC-16176-02 100 µL

Recombinant FGF19 Antibody

Sign In for Pricing
View Details
Recombinant FGF19 Antibody
RC-16176-03 1 mL

Recombinant FGF19 Antibody

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2908R), CF647 conjugate, 0.1mg/mL
BNC472908-100 1x 100 µL

CD68 (Macrophage Marker) (C68/2908R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details