Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 24 (TVA24)

This Recombinant Human T cell receptor alpha variable 24 (TVA24) spans the amino acid sequence from region 23-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 24 TRAV24

UniProt

A0A0B4J272

Expression Region

23-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Histone H3 (acetyl K27) Antibody
RC-5553-01 50 μL

Recombinant Histone H3 (acetyl K27) Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (acetyl K27) Antibody
RC-5553-02 100 µL

Recombinant Histone H3 (acetyl K27) Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (acetyl K27) Antibody
RC-5553-03 1 mL

Recombinant Histone H3 (acetyl K27) Antibody

Sign In for Pricing
View Details
CD5 Recombinant Rabbit Monoclonal Antibody [PD00-01]
HA721137 100 µL

CD5 Recombinant Rabbit Monoclonal Antibody [PD00-01]

Sign In for Pricing
View Details
Sunset Yellow (E110) D4 (phenyl D4)
TRC-S825005-50MG 50 mg

Sunset Yellow (E110) D4 (phenyl D4)

Sign In for Pricing
View Details
DNA PKcs (PRKDC) Rabbit Monoclonal Antibody
TA422292 100 µL

DNA PKcs (PRKDC) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details