Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 24 (TVA24)

This Recombinant Human T cell receptor alpha variable 24 (TVA24) spans the amino acid sequence from region 23-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 24 TRAV24

UniProt

A0A0B4J272

Expression Region

23-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORO1B Adenovirus (Mouse)
16654054 1.0 mL

CORO1B Adenovirus (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal CD35 Antibody (To5) [Janelia Fluor 549]
NBP3-08279JF549 100 µL

Mouse Monoclonal CD35 Antibody (To5) [Janelia Fluor 549]

Sign In for Pricing
View Details
CYP8B1 Polyclonal Antibody, HRP Conjugated
bs-14165R-HRP-01 20 µL

CYP8B1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
CYP8B1 Polyclonal Antibody, HRP Conjugated
bs-14165R-HRP-02 100 µL

CYP8B1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Ephrin-A1 Antibody
NBP3-21329-100ul 100 µL

Rabbit Polyclonal Ephrin-A1 Antibody

Sign In for Pricing
View Details
LOC498236 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6004402 1.0 µg DNA

LOC498236 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details