Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 20 (TVA20)

This Recombinant Human T cell receptor alpha variable 20 (TVA20) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 20 TRAV20

UniProt

A0A0B4J274

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HNF6b ELISA Kit
EHH0095 96 Tests

Human HNF6b ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor ligand superfamily member 12 ELISA Kit
MBS9427877-01 96 Tests

Human Tumor necrosis factor ligand superfamily member 12 ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor ligand superfamily member 12 ELISA Kit
MBS9427877-02 5x 96 Tests

Human Tumor necrosis factor ligand superfamily member 12 ELISA Kit

Sign In for Pricing
View Details
Human GPR124 ELISA Kit
orb756748-01 48 Tests

Human GPR124 ELISA Kit

Sign In for Pricing
View Details
Human GPR124 ELISA Kit
orb756748-02 96 Tests

Human GPR124 ELISA Kit

Sign In for Pricing
View Details
ACTB/POTEKP/ACTG1 Monoclonal Antibody
A76589-50UL 50 μL

ACTB/POTEKP/ACTG1 Monoclonal Antibody

Sign In for Pricing
View Details