Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 17 (TVA17)

This Recombinant Human T cell receptor alpha variable 17 (TVA17) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 17 TRAV17

UniProt

A0A0B4J275

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CPNE1 Protein, N-His & C-His
YHP27101 100 μg

Recombinant Human CPNE1 Protein, N-His & C-His

Sign In for Pricing
View Details
PRA1 Antibody, FITC conjugated
A50148-100UL 100 µL

PRA1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Frizzled/smoothened-like sans CRD protein B (fscB)
orb2904411-01 20 µg

Recombinant Dictyostelium discoideum Frizzled/smoothened-like sans CRD protein B (fscB)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Frizzled/smoothened-like sans CRD protein B (fscB)
orb2904411-02 100 µg

Recombinant Dictyostelium discoideum Frizzled/smoothened-like sans CRD protein B (fscB)

Sign In for Pricing
View Details
Fish Aminopeptidase,AMP ELISA KIT
JOT-EK0092FI 96 wells

Fish Aminopeptidase,AMP ELISA KIT

Sign In for Pricing
View Details
MAT2B Protein Vector (Mouse) (pPM-C-HA)
28145025 500 ng

MAT2B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details