Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 17 (TVA17)

This Recombinant Human T cell receptor alpha variable 17 (TVA17) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 17 TRAV17

UniProt

A0A0B4J275

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC02868 Human qPCR Primer Pair (NM_001013643)
HP202336 200 Reactions

LINC02868 Human qPCR Primer Pair (NM_001013643)

Sign In for Pricing
View Details
2- (3- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) ethanol
OR91136-01 100 mg

2- (3- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) ethanol

Sign In for Pricing
View Details
2- (3- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) ethanol
OR91136-02 250 mg

2- (3- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) ethanol

Sign In for Pricing
View Details
2- (3- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) ethanol
OR91136-03 1 g

2- (3- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) ethanol

Sign In for Pricing
View Details
2- (3- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) ethanol
OR91136-04 5 g

2- (3- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) ethanol

Sign In for Pricing
View Details
Sh3rf2 (NM_001146299) Mouse Tagged ORF Clone Lentiviral Particle
MR215957L4V 200 µL

Sh3rf2 (NM_001146299) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details