Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 25 (TVA25)

This Recombinant Human T cell receptor alpha variable 25 (TVA25) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 25 TRAV25

UniProt

A0A0B4J276

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Olfr1407-ps1 activation kit by CRISPRa
GA215388 1 Kit

Mouse Olfr1407-ps1 activation kit by CRISPRa

Sign In for Pricing
View Details
Lentiviral mouse Hipk2 shRNA (UAS) - Lentiviral mouse Hipk2 shRNA (UAS, iRFP) plasmid
GTR15207832 1 Vial

Lentiviral mouse Hipk2 shRNA (UAS) - Lentiviral mouse Hipk2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
ECHDC2 Antibody FITC Conjugated
orb3157637 100 µg

ECHDC2 Antibody FITC Conjugated

Sign In for Pricing
View Details
Protein Phosphatase, Mg2+/Mn2+ Dependent 1A (PPM1A) BioAssayTM ELISA Kit (Rat)
027740 96 Tests

Protein Phosphatase, Mg2+/Mn2+ Dependent 1A (PPM1A) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
GABRR1 Conjugated Antibody
MBS9444087-01 0.1 mL (Biotin)

GABRR1 Conjugated Antibody

Sign In for Pricing
View Details
GABRR1 Conjugated Antibody
MBS9444087-02 0.1 mL (AF350)

GABRR1 Conjugated Antibody

Sign In for Pricing
View Details