Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21)

This Recombinant Human T cell receptor alpha variable 21 (TVA21) spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMCC1P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2383905 3x 1.0 µg

TMCC1P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
COL9A2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0484107 1.0 µg DNA

COL9A2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ARHGEF9 (NM_001173479) Human Tagged ORF Clone
RC230127 10 µg

ARHGEF9 (NM_001173479) Human Tagged ORF Clone

Sign In for Pricing
View Details
TRNAI10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2493507 1.0 µg DNA

TRNAI10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
BACE2 Blocking Peptide
33R-8612 0.1 mg

BACE2 Blocking Peptide

Sign In for Pricing
View Details
Thioglycolate Broth with Resazurine
B2017505 500 g

Thioglycolate Broth with Resazurine

Sign In for Pricing
View Details