Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40)

This Recombinant Human T cell receptor alpha variable 40 (TVA40) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS709479 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Amplite® Colorimetric Phosphofructokinase (PFK) Activity Assay Kit
11329-AAT 100 Tests

Amplite® Colorimetric Phosphofructokinase (PFK) Activity Assay Kit

Sign In for Pricing
View Details
hnRNP L (HNRNPL) Rabbit Polyclonal Antibody
AP18050PU-N 400 µL

hnRNP L (HNRNPL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DLL1 Human Gene Knockout Kit (CRISPR)
KN222399LP 1 Kit

DLL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Aminodiphenyl Sulfide
TRC-A624015-1G 1 g

2-Aminodiphenyl Sulfide

Sign In for Pricing
View Details
FOXB1 Polyclonal Antibody
E-AB-66439-01 60 µL

FOXB1 Polyclonal Antibody

Sign In for Pricing
View Details