Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40)

This Recombinant Human T cell receptor alpha variable 40 (TVA40) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTX2 Mouse Monoclonal Antibody [Clone ID: 1H12C4B5]
AM06629SU-N 100 µL

OTX2 Mouse Monoclonal Antibody [Clone ID: 1H12C4B5]

Sign In for Pricing
View Details
Histone H3 (Ab-28) Antibody
8B0435-AAT 50 µg

Histone H3 (Ab-28) Antibody

Sign In for Pricing
View Details
TRPM2 (1139-1150) Goat Polyclonal Antibody
AP23104PU-N 50 µg

TRPM2 (1139-1150) Goat Polyclonal Antibody

Sign In for Pricing
View Details
NIP30 (FAM192A) (NM_024946) Human Recombinant Protein
TP304378 20 µg

NIP30 (FAM192A) (NM_024946) Human Recombinant Protein

Sign In for Pricing
View Details
MUC20 (NM_020790) Human Tagged ORF Clone
RG238880 10 µg

MUC20 (NM_020790) Human Tagged ORF Clone

Sign In for Pricing
View Details
SERINC1 (NM_020755) Human Over-expression Lysate
LC402801 20 µg

SERINC1 (NM_020755) Human Over-expression Lysate

Sign In for Pricing
View Details