Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40)

This Recombinant Human T cell receptor alpha variable 40 (TVA40) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1 domain family member 21 (TBC1D21) Human ELISA Kit
H4812 96 Tests

TBC1 domain family member 21 (TBC1D21) Human ELISA Kit

Sign In for Pricing
View Details
Mouse Microseminoprotein Beta (MSMb) ELISA Kit
DL-MSMb-Mu-01 48 Tests

Mouse Microseminoprotein Beta (MSMb) ELISA Kit

Sign In for Pricing
View Details
Mouse Microseminoprotein Beta (MSMb) ELISA Kit
DL-MSMb-Mu-02 96 Tests

Mouse Microseminoprotein Beta (MSMb) ELISA Kit

Sign In for Pricing
View Details
Phospho-Histone H3 (Thr3) Antibody [C4K12]
C15751-100uL 100 µL

Phospho-Histone H3 (Thr3) Antibody [C4K12]

Sign In for Pricing
View Details
RPL7AP7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1882005 3x 1.0 µg

RPL7AP7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Olr250 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV633992 1.0 µg DNA

Olr250 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details