Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D)

This Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69D IGHV1-69D

UniProt

A0A0B4J2H0

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sec-Butylmalonic Acid Diethyl Ester
TRC-B692610-1G 1 g

sec-Butylmalonic Acid Diethyl Ester

Sign In for Pricing
View Details
Human CORO7-PAM16 activation kit by CRISPRa
GA119365 1 Kit

Human CORO7-PAM16 activation kit by CRISPRa

Sign In for Pricing
View Details
MST2 Recombinant Rabbit Monoclonal Antibody [SC05-83]
ET1610-8 100 µL

MST2 Recombinant Rabbit Monoclonal Antibody [SC05-83]

Sign In for Pricing
View Details
IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), CF740 conjugate, 0.1mg/mL
BNC743775-500 1x 500 µL

IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM55 Antibody
KC-3929-01 50 μL

TRIM55 Antibody

Sign In for Pricing
View Details
TRIM55 Antibody
KC-3929-02 100 µL

TRIM55 Antibody

Sign In for Pricing
View Details