Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D)

This Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69D IGHV1-69D

UniProt

A0A0B4J2H0

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Hydroxy-7-iodoquinoline-5-sulfonic Acid
TRC-H943678-500MG 500 mg

8-Hydroxy-7-iodoquinoline-5-sulfonic Acid

Sign In for Pricing
View Details
Convicine
TRC-C685095-5MG 5 mg

Convicine

Sign In for Pricing
View Details
alpha Synuclein (SNCA) (NACP140) Goat Polyclonal Antibody
AP32036PU-N 100 µg

alpha Synuclein (SNCA) (NACP140) Goat Polyclonal Antibody

Sign In for Pricing
View Details
CHRNE Goat Polyclonal Antibody
AP32144PU-N 100 µg

CHRNE Goat Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB623420 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
FGFR2 (IIIb), AlpHcAbs® Human
HA710328 100 µg

FGFR2 (IIIb), AlpHcAbs® Human

Sign In for Pricing
View Details