Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D)

This Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69D IGHV1-69D

UniProt

A0A0B4J2H0

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSKH2 Human shRNA Plasmid Kit (Locus ID 85481)
TF302231 1 Kit

PSKH2 Human shRNA Plasmid Kit (Locus ID 85481)

Sign In for Pricing
View Details
Bovine Tryptophan 2,3-dioxygenase, TDO2 ELISA KIT
ELI-53073b 96 Tests

Bovine Tryptophan 2,3-dioxygenase, TDO2 ELISA KIT

Sign In for Pricing
View Details
Amylase Blocking Peptide
33R-10999 50 ug

Amylase Blocking Peptide

Sign In for Pricing
View Details
Homoquinolinic acid
sc-200456 5 mg

Homoquinolinic acid

Sign In for Pricing
View Details
Anti-ITK Monoclonal Antibody
MBS1752090-01 0.03 mL

Anti-ITK Monoclonal Antibody

Sign In for Pricing
View Details
Anti-ITK Monoclonal Antibody
MBS1752090-02 0.1 mL

Anti-ITK Monoclonal Antibody

Sign In for Pricing
View Details