Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6-21 (KV621)

This Recombinant Human Immunoglobulin kappa variable 6-21 (KV621) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6-21 IGKV6-21

UniProt

A0A0C4DH24

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PXK Antibody, FITC conjugated
MBS7103241-01 0.05 mg

PXK Antibody, FITC conjugated

Sign In for Pricing
View Details
PXK Antibody, FITC conjugated
MBS7103241-02 0.1 mg

PXK Antibody, FITC conjugated

Sign In for Pricing
View Details
PXK Antibody, FITC conjugated
MBS7103241-03 5x 0.1 mg

PXK Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Streptococcus Sanguinis SSA_1550 Protein (aa 1-145)
VAng-Cr8284-50gEcoli 50 µg (E. coli)

Recombinant Streptococcus Sanguinis SSA_1550 Protein (aa 1-145)

Sign In for Pricing
View Details
GENLISA™ Human Carbon Catabolite Repression 4 Like Protein (CCRN4L) ELISA
KBH20381 1x 96 Well

GENLISA™ Human Carbon Catabolite Repression 4 Like Protein (CCRN4L) ELISA

Sign In for Pricing
View Details
Recombinant Human UBQLN1 Protein
E30P69929A 50 µg

Recombinant Human UBQLN1 Protein

Sign In for Pricing
View Details