Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20)

This Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20) spans the amino acid sequence from region 21-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-20 IGKV3D-20

UniProt

A0A0C4DH25

Expression Region

21-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCGASQSVSSSYLAWYQQKPGLAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Totalblot™ Northern Kit without Membrane
20810007-1 1 Kit

Totalblot™ Northern Kit without Membrane

Sign In for Pricing
View Details
Human Arginine--tRNA Ligase, Cytoplasmic (RARS1) ELISA Kit
abx152928-01 96 Tests

Human Arginine--tRNA Ligase, Cytoplasmic (RARS1) ELISA Kit

Sign In for Pricing
View Details
Human Arginine--tRNA Ligase, Cytoplasmic (RARS1) ELISA Kit
abx152928-02 5x 96 Tests

Human Arginine--tRNA Ligase, Cytoplasmic (RARS1) ELISA Kit

Sign In for Pricing
View Details
Human Arginine--tRNA Ligase, Cytoplasmic (RARS1) ELISA Kit
abx152928-03 10x 96 Tests

Human Arginine--tRNA Ligase, Cytoplasmic (RARS1) ELISA Kit

Sign In for Pricing
View Details
Stool Cell DNA Auto Plate
301687 96 Tests

Stool Cell DNA Auto Plate

Sign In for Pricing
View Details
Anti-ADIPOR1 Antibody
B2020988 100 µL

Anti-ADIPOR1 Antibody

Sign In for Pricing
View Details