Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 8 (TRGV8)

This Recombinant Human T cell receptor gamma variable 8 (TRGV8) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 8 TRGV8 TCRGV8

UniProt

A0A0C4DH27

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVTRPTGSSAVITCDLPVENAVYTHWYLHQEGKAPQRLLYYDSYNSRVVLESGISREKYHTYASTGKSLKFILENLIERDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAVL4 Rabbit Polyclonal Antibody (FITC)
orb2619780 100 µg

ELAVL4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Gemin 2 (GEMIN2) Mouse Monoclonal Antibody [Clone 4B3]
E45M18569V-2 50 µL

Gemin 2 (GEMIN2) Mouse Monoclonal Antibody [Clone 4B3]

Sign In for Pricing
View Details
Atp5f1 siRNA Oligos set (Mouse)
12715174 3x 5 nmol

Atp5f1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans unc-60 Polyclonal Antibody
MBS7143944 Inquire

Rabbit anti-Caenorhabditis elegans unc-60 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Smooth muscle Myosin (SMM) ELISA Kit
MBS262024-01 48 Well

Rat Smooth muscle Myosin (SMM) ELISA Kit

Sign In for Pricing
View Details
Rat Smooth muscle Myosin (SMM) ELISA Kit
MBS262024-02 96 Well

Rat Smooth muscle Myosin (SMM) ELISA Kit

Sign In for Pricing
View Details