Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 8 (TRGV8)

This Recombinant Human T cell receptor gamma variable 8 (TRGV8) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 8 TRGV8 TCRGV8

UniProt

A0A0C4DH27

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVTRPTGSSAVITCDLPVENAVYTHWYLHQEGKAPQRLLYYDSYNSRVVLESGISREKYHTYASTGKSLKFILENLIERDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain UTI89/UPEC) MNMA Polyclonal Antibody
MBS7192211 Inquire

Rabbit anti-Escherichia coli (strain UTI89/UPEC) MNMA Polyclonal Antibody

Sign In for Pricing
View Details
Cantharidin
abx076671-01 20 mg

Cantharidin

Sign In for Pricing
View Details
Cantharidin
abx076671-02 100 mg

Cantharidin

Sign In for Pricing
View Details
RPS12 Antibody
MBS8582842-01 0.1 mL

RPS12 Antibody

Sign In for Pricing
View Details
RPS12 Antibody
MBS8582842-02 0.1 mL (AF635)

RPS12 Antibody

Sign In for Pricing
View Details
RPS12 Antibody
MBS8582842-03 0.1 mL (AF610)

RPS12 Antibody

Sign In for Pricing
View Details