Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 4 (TRGV4)

This Recombinant Human T cell receptor gamma variable 4 (TRGV4) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 4 TRGV4 TCRGV4

UniProt

A0A0C4DH28

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPH3AL siRNA (Human)
MBS8221848-01 15 nmol

RPH3AL siRNA (Human)

Sign In for Pricing
View Details
RPH3AL siRNA (Human)
MBS8221848-02 30 nmol

RPH3AL siRNA (Human)

Sign In for Pricing
View Details
RPH3AL siRNA (Human)
MBS8221848-03 5x 30 nmol

RPH3AL siRNA (Human)

Sign In for Pricing
View Details
Olr132 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7427206 1.0 µg DNA

Olr132 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
AsPC-1/STAT3 Reporter (Luc) stable cell line
GTR15424197 1 Vial

AsPC-1/STAT3 Reporter (Luc) stable cell line

Sign In for Pricing
View Details
Human NAP1L2 (NM_021963) AAV Particle
RC205257A1V 250 µL

Human NAP1L2 (NM_021963) AAV Particle

Sign In for Pricing
View Details