Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 4 (TRGV4)

This Recombinant Human T cell receptor gamma variable 4 (TRGV4) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 4 TRGV4 TCRGV4

UniProt

A0A0C4DH28

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL8 ELISA Kit (Bovine)
OKEH03781-96W 96 Tests

IL8 ELISA Kit (Bovine)

Sign In for Pricing
View Details
USF2 (Upstream Stimulatory Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Upstream Transcription Factor 2) (MaxLight 405)
MBS6193346-01 0.1 mL

USF2 (Upstream Stimulatory Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Upstream Transcription Factor 2) (MaxLight 405)

Sign In for Pricing
View Details
USF2 (Upstream Stimulatory Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Upstream Transcription Factor 2) (MaxLight 405)
MBS6193346-02 5x 0.1 mL

USF2 (Upstream Stimulatory Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Upstream Transcription Factor 2) (MaxLight 405)

Sign In for Pricing
View Details
PCMV-3xMyc-Ub-K63-Neo
BZ52300 1 Vial

PCMV-3xMyc-Ub-K63-Neo

Sign In for Pricing
View Details
Rps27l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4954807 1.0 µg DNA

Rps27l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human SPHK1 (Sphingosine Kinase 1) ELISA Kit
RE2537H-01 48 Tests

Human SPHK1 (Sphingosine Kinase 1) ELISA Kit

Sign In for Pricing
View Details