Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-3 (HV103)

This Recombinant Human Immunoglobulin heavy variable 1-3 (HV103) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-3 IGHV1-3

UniProt

A0A0C4DH29

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (CPTC-SULT1E1-1) [Alexa Fluor 488]
NBP3-08212AF488 100 µL

Mouse Monoclonal Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (CPTC-SULT1E1-1) [Alexa Fluor 488]

Sign In for Pricing
View Details
Dnaaf1 Rat siRNA Oligo Duplex (Locus ID 361419)
SR505031 1 Kit

Dnaaf1 Rat siRNA Oligo Duplex (Locus ID 361419)

Sign In for Pricing
View Details
Akt Polyclonal Antibody
E040567 100 µg -100 µL

Akt Polyclonal Antibody

Sign In for Pricing
View Details
Sumo 2/3 Polyclonal Antibody Bio Conjugated
MBS9463954-01 0.1 mL

Sumo 2/3 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
Sumo 2/3 Polyclonal Antibody Bio Conjugated
MBS9463954-02 5x 0.1 mL

Sumo 2/3 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens GTPase obg (obg)
MBS1344412-01 0.02 mg (E-Coli)

Recombinant Pseudomonas fluorescens GTPase obg (obg)

Sign In for Pricing
View Details