Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-16 IGHV3-16

UniProt

A0A0C4DH30

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWARKAPGKGLEWVSGVSWNGSRTHYVDSVKRRFIISRDNSRNSLYLQKNRRRAEDMAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1b (RIV12), CF568 conjugate, 0.1mg/mL
BNC680317-500 1x 500 µL

CD1b (RIV12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIII (F13B) Mouse Monoclonal Antibody [Clone ID: OTI2D4]
CF806464 100 µg

Factor XIII (F13B) Mouse Monoclonal Antibody [Clone ID: OTI2D4]

Sign In for Pricing
View Details
CD34 Class I Mouse Monoclonal Antibody [Clone ID: B-C34]
AM31235AF-N 200 µg

CD34 Class I Mouse Monoclonal Antibody [Clone ID: B-C34]

Sign In for Pricing
View Details
TSG101 (N-term) Rabbit Polyclonal Antibody
AP12055PU-N 400 µL

TSG101 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPA33 (NM_005814) Human Recombinant Protein
TP720397XL 1 mg

GPA33 (NM_005814) Human Recombinant Protein

Sign In for Pricing
View Details
GLIPR1 Human Gene Knockout Kit (CRISPR)
KN416882 1 Kit

GLIPR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details