Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-16 IGHV3-16

UniProt

A0A0C4DH30

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWARKAPGKGLEWVSGVSWNGSRTHYVDSVKRRFIISRDNSRNSLYLQKNRRRAEDMAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF594 conjugate, 0.1mg/mL
BNC941700-500 1x 500 µL

CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2808R), CF640R conjugate, 0.1mg/mL
BNC402808-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2808R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,2,4-Benzenetricarboxylic Acid 1,2-Bis(2-ethylhexyl) Ester
TRC-B190030-2.5MG 2.5 mg

1,2,4-Benzenetricarboxylic Acid 1,2-Bis(2-ethylhexyl) Ester

Sign In for Pricing
View Details
Rabies (Rab-50), Biotin conjugate, 0.1mg/mL
BNCB0943-500 1x 500 µL

Rabies (Rab-50), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD2 Antibody[TS1/8]
E-AB-F1148I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD2 Antibody[TS1/8]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD2 Antibody[TS1/8]
E-AB-F1148I-02 100 Tests

PE/Cyanine5.5 Anti-Human CD2 Antibody[TS1/8]

Sign In for Pricing
View Details