Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-24 (HV124)

This Recombinant Human Immunoglobulin heavy variable 1-24 (HV124) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-24 IGHV1-24

UniProt

A0A0C4DH33

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTR4 antibody
70R-30674 100 ug

HTR4 antibody

Sign In for Pricing
View Details
Anti-SERINC3 Antibody Picoband®, HRP Conjugate
A05936-2-HRP 100 µg/Vial

Anti-SERINC3 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
FOXD3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2284022 100 µL

FOXD3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
CECR2 IP Mouse Monoclonal Antibody
orb2956665-01 50 µg

CECR2 IP Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CECR2 IP Mouse Monoclonal Antibody
orb2956665-02 100 µg

CECR2 IP Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CECR2 IP Mouse Monoclonal Antibody
orb2956665-03 1 mg

CECR2 IP Mouse Monoclonal Antibody

Sign In for Pricing
View Details