Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-35 IGHV3-35

UniProt

A0A0C4DH35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWVHQAPGKGLEWVSGVSWNGSRTHYADSVKGRFIISRDNSRNTLYLQTNSLRAEDTAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF1 Antibody - middle region
AVARP09008_P050-25UL 25 µL

TRAF1 Antibody - middle region

Sign In for Pricing
View Details
Biotin Conjugated Affinity Purified Anti-RABBIT IgG (H&L) (GOAT)
GWB-16F495 2 mg

Biotin Conjugated Affinity Purified Anti-RABBIT IgG (H&L) (GOAT)

Sign In for Pricing
View Details
CAPSO
sc-239475 25 g

CAPSO

Sign In for Pricing
View Details
2- (5-Cyclopropyl-1H-1,2,3,4-tetrazol-1-yl) acetic acid
SAC11783-01 100 mg

2- (5-Cyclopropyl-1H-1,2,3,4-tetrazol-1-yl) acetic acid

Sign In for Pricing
View Details
2- (5-Cyclopropyl-1H-1,2,3,4-tetrazol-1-yl) acetic acid
SAC11783-02 1 g

2- (5-Cyclopropyl-1H-1,2,3,4-tetrazol-1-yl) acetic acid

Sign In for Pricing
View Details
Syk (Y525/526) Antibody
E45R33512G-4 50 µL

Syk (Y525/526) Antibody

Sign In for Pricing
View Details