Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-35 IGHV3-35

UniProt

A0A0C4DH35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWVHQAPGKGLEWVSGVSWNGSRTHYADSVKGRFIISRDNSRNTLYLQTNSLRAEDTAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTHFD2 Rabbit Polyclonal Antibody (Fluoro594)
orb3101822 100 µg

MTHFD2 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
NACC2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
31392124 3x 1.0µg DNA

NACC2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
PODXL Polyclonal Antibody
E910200 100 µL

PODXL Polyclonal Antibody

Sign In for Pricing
View Details
Ether Petroleum 40⁰-60⁰C Extrapure
01131 02500 2.5 L

Ether Petroleum 40⁰-60⁰C Extrapure

Sign In for Pricing
View Details
Olr1315 (NM_001000469) Rat Tagged Lenti ORF Clone
RR210770L4 10 µg

Olr1315 (NM_001000469) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CACNG5 Protein Vector (Mouse) (pPB-N-His)
PV160959 500 ng

CACNG5 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details