Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38 IGHV3-38

UniProt

A0A0C4DH36

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAVYYCARY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), Biotin Conjugate
#29102 1x 1 mL

Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), Biotin Conjugate

Sign In for Pricing
View Details
N-2-Pyridinyl-1,2-ethanediamine
TRC-P993325-250MG 250 mg

N-2-Pyridinyl-1,2-ethanediamine

Sign In for Pricing
View Details
Bis(4-nitrophenyl) Carbonate
TRC-B506130-50G 50 g

Bis(4-nitrophenyl) Carbonate

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-100 1x 100 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant RhoGDI Antibody
RC-5901-01 50 μL

Recombinant RhoGDI Antibody

Sign In for Pricing
View Details
Recombinant RhoGDI Antibody
RC-5901-02 100 µL

Recombinant RhoGDI Antibody

Sign In for Pricing
View Details