Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38 IGHV3-38

UniProt

A0A0C4DH36

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAVYYCARY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A Br
HA25031501.25G 25 g

Polystyrene A Br

Sign In for Pricing
View Details
MEK3 (MAP2K3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E2]
TA505839BM 100 µL

MEK3 (MAP2K3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E2]

Sign In for Pricing
View Details
Frozen Tissue Sections, Small intestine
CS502638 5x 5 µm

Frozen Tissue Sections, Small intestine

Sign In for Pricing
View Details
MPPED2 Rabbit Polyclonal Antibody
TA365776 100 µL

MPPED2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant 53BP1 Antibody
RC-16788-01 50 μL

Recombinant 53BP1 Antibody

Sign In for Pricing
View Details
Recombinant 53BP1 Antibody
RC-16788-02 100 µL

Recombinant 53BP1 Antibody

Sign In for Pricing
View Details