Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-51 (HV551)

This Recombinant Human Immunoglobulin heavy variable 5-51 (HV551) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-51 IGHV5-51

UniProt

A0A0C4DH38

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cish Antibody
MBS5313070-01 0.1 mg

Cish Antibody

Sign In for Pricing
View Details
Cish Antibody
MBS5313070-02 5x 0.1 mg

Cish Antibody

Sign In for Pricing
View Details
CCDC107
CSB-CL837855HU 10 μg Plasmid + 200 μL Glycerol

CCDC107

Sign In for Pricing
View Details
Porcine FAIM3 (Fas Apoptotic Inhibitory Molecule 3) ELISA Kit
MBS2510854-01 24 Tests

Porcine FAIM3 (Fas Apoptotic Inhibitory Molecule 3) ELISA Kit

Sign In for Pricing
View Details
Porcine FAIM3 (Fas Apoptotic Inhibitory Molecule 3) ELISA Kit
MBS2510854-02 48 Tests

Porcine FAIM3 (Fas Apoptotic Inhibitory Molecule 3) ELISA Kit

Sign In for Pricing
View Details
Porcine FAIM3 (Fas Apoptotic Inhibitory Molecule 3) ELISA Kit
MBS2510854-03 96 Tests

Porcine FAIM3 (Fas Apoptotic Inhibitory Molecule 3) ELISA Kit

Sign In for Pricing
View Details