Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-66 (HV366)

This Recombinant Human Immunoglobulin heavy variable 3-66 (HV366) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-66 IGHV3-66

UniProt

A0A0C4DH42

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSCGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poly (vinylsulfonic Acid
OR1023712 1 Each

Poly (vinylsulfonic Acid

Sign In for Pricing
View Details
LIPK, CT (LIPK, LIPL2, Lipase member K, Lipase-like abhydrolase domain-containing protein 2) (MaxLight 550)
MBS6316445-01 0.1 mL

LIPK, CT (LIPK, LIPL2, Lipase member K, Lipase-like abhydrolase domain-containing protein 2) (MaxLight 550)

Sign In for Pricing
View Details
LIPK, CT (LIPK, LIPL2, Lipase member K, Lipase-like abhydrolase domain-containing protein 2) (MaxLight 550)
MBS6316445-02 5x 0.1 mL

LIPK, CT (LIPK, LIPL2, Lipase member K, Lipase-like abhydrolase domain-containing protein 2) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Shigella Sonnei sufS Protein (aa 1-406)
VAng-0217Lsx-50gEcoli 50 µg (E. coli)

Recombinant Shigella Sonnei sufS Protein (aa 1-406)

Sign In for Pricing
View Details
Recombinant Human CBX3
orb1098548-01 50 µg

Recombinant Human CBX3

Sign In for Pricing
View Details
Recombinant Human CBX3
orb1098548-02 100 µg

Recombinant Human CBX3

Sign In for Pricing
View Details