Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D)

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYNC2H1 Human Gene Knockout Kit (CRISPR)
KN435408 1 Kit

DYNC2H1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TATA binding protein TBP Rabbit Polyclonal Antibody
HA500518 100 µL

TATA binding protein TBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF488A conjugate, 0.1mg/mL
BNC880780-100 1x 100 µL

HSP60 (HSPD1/780), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Thymus
CR559647 5 µg

Tissue Total RNA, Thymus

Sign In for Pricing
View Details
4-Ethenyl-1,1-difluoro-cyclohexane
TRC-E415470-250MG 250 mg

4-Ethenyl-1,1-difluoro-cyclohexane

Sign In for Pricing
View Details
Human IgM Immunoglobulin (IM373), CF568 conjugate, 0.1mg/mL
BNC680373-500 1x 500 µL

Human IgM Immunoglobulin (IM373), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details