Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D)

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Longifolenaldehyde
TRC-L469425-2.5MG 2.5 mg

Longifolenaldehyde

Sign In for Pricing
View Details
EPM2A Polyclonal Antibody
E-AB-18758-01 20 µL

EPM2A Polyclonal Antibody

Sign In for Pricing
View Details
EPM2A Polyclonal Antibody
E-AB-18758-02 60 µL

EPM2A Polyclonal Antibody

Sign In for Pricing
View Details
EPM2A Polyclonal Antibody
E-AB-18758-03 120 µL

EPM2A Polyclonal Antibody

Sign In for Pricing
View Details
EPM2A Polyclonal Antibody
E-AB-18758-04 200 µL

EPM2A Polyclonal Antibody

Sign In for Pricing
View Details
Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody
AP20608PU-N 100 µg

Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details