Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D)

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Rat ACE2 (Angiotensin I Converting Enzyme 2) ELISA Kit
E-UNEL-R0077-01 5x 96 Tests

Uncoated Rat ACE2 (Angiotensin I Converting Enzyme 2) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat ACE2 (Angiotensin I Converting Enzyme 2) ELISA Kit
E-UNEL-R0077-02 15x 96 Tests

Uncoated Rat ACE2 (Angiotensin I Converting Enzyme 2) ELISA Kit

Sign In for Pricing
View Details
1-Acetoxy-4-(N-acetyl-L-cysteinyl)-2-butanone
TRC-A164250-100MG 100 mg

1-Acetoxy-4-(N-acetyl-L-cysteinyl)-2-butanone

Sign In for Pricing
View Details
Mouse Monoclonal Goblet Cells Antibody (FIS 3G12/3) [Alexa Fluor 488]
NBP2-50414AF488 0.1 mL

Mouse Monoclonal Goblet Cells Antibody (FIS 3G12/3) [Alexa Fluor 488]

Sign In for Pricing
View Details
CDC42SE1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
15629154 3x 1.0 µg DNA

CDC42SE1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
HABP4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV640166 1.0 µg DNA

HABP4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details