Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-8 (KV108)

This Recombinant Human Immunoglobulin kappa variable 1-8 (KV108) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-8 IGKV1-8

UniProt

A0A0C4DH67

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPSSFSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human NCALD Polyclonal Antibody
HX055014-01 50 µg

Anti-Human NCALD Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human NCALD Polyclonal Antibody
HX055014-02 100 µg

Anti-Human NCALD Polyclonal Antibody

Sign In for Pricing
View Details
MCM6 (Minichromosome Maintenance Protein 6, DNA Replication Licensing Factor MCM6, MCG40308, Minichromosome Maintenance Deficient (mis5 S. pombe) 6, MIS5 Homolog, P105MCM) (MaxLight 750) discontinued
M2749-36F-ML750 100 µL

MCM6 (Minichromosome Maintenance Protein 6, DNA Replication Licensing Factor MCM6, MCG40308, Minichromosome Maintenance Deficient (mis5 S. pombe) 6, MIS5 Homolog, P105MCM) (MaxLight 750) discontinued

Sign In for Pricing
View Details
AsCpf1/Cas12a (Strain BV3L6) (E1U7C) Rabbit Monoclonal Antibody
CST 19984T 20 µL

AsCpf1/Cas12a (Strain BV3L6) (E1U7C) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rasl2-9-ps siRNA Oligos set (Mouse)
38551174 3x 5 nmol

Rasl2-9-ps siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Mouse Cep104 qPCR Primer Pair
QM59530S 200 Tests

Mouse Cep104 qPCR Primer Pair

Sign In for Pricing
View Details