Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-24 (KV224)

This Recombinant Human Immunoglobulin kappa variable 2-24 (KV224) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-24 IGKV2-24

UniProt

A0A0C4DH68

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKISNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP1A2 siRNA (h)
sc-41485 10 µM

CYP1A2 siRNA (h)

Sign In for Pricing
View Details
Pnck ORF Vector (Mouse) (pORF)
ORF054369 1.0 µg DNA

Pnck ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Hlxb9 3'UTR GFP Stable Cell Line
TU255827 1.0 mL

Hlxb9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Arginase 1 Antibody
E38PA1074 100 µL

Arginase 1 Antibody

Sign In for Pricing
View Details
Donkey Interleukin 12 Receptor Beta 2 ELISA Kit
MBS063208 Inquire

Donkey Interleukin 12 Receptor Beta 2 ELISA Kit

Sign In for Pricing
View Details
Anti-Human TRDV2 Polyclonal Antibody
PHK41101 100 μg

Anti-Human TRDV2 Polyclonal Antibody

Sign In for Pricing
View Details