Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-6 (KV106)

This Recombinant Human Immunoglobulin kappa variable 1-6 (KV106) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-6 IGKV1-6

UniProt

A0A0C4DH72

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF740 conjugate, 0.1mg/mL
BNC741796-100 1x 100 µL

CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retinal S antigen (SAG) (NM_000541) Human Recombinant Protein
TP320057L 1 mg

Retinal S antigen (SAG) (NM_000541) Human Recombinant Protein

Sign In for Pricing
View Details
NMDAR1 (GRIN1) pSer897 Rabbit Polyclonal Antibody
AP20959PU-N 100 µg

NMDAR1 (GRIN1) pSer897 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRAMEF12 Human Gene Knockout Kit (CRISPR)
KN417166 1 Kit

PRAMEF12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyclohexane
TRC-C991300-500ML 500 mL

Cyclohexane

Sign In for Pricing
View Details
NAD-Hexylamine, Lithium Salt
#10064 1x 1 mg

NAD-Hexylamine, Lithium Salt

Sign In for Pricing
View Details