Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-6 (KV106)

This Recombinant Human Immunoglobulin kappa variable 1-6 (KV106) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-6 IGKV1-6

UniProt

A0A0C4DH72

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM19 Double Nickase Plasmid (m2)
sc-428729-NIC-2 20 µg

RBM19 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Influenza A H1N1 (A/swine/England/267/2007) Hemagglutinin / HA Protein (His Tag)
PO55155M2 100 µg

Influenza A H1N1 (A/swine/England/267/2007) Hemagglutinin / HA Protein (His Tag)

Sign In for Pricing
View Details
Anti-Cytokeratin 17 Antibody, Rabbit Polyclonal
MBS8101861-01 0.1 mL

Anti-Cytokeratin 17 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Cytokeratin 17 Antibody, Rabbit Polyclonal
MBS8101861-02 5x 0.1 mL

Anti-Cytokeratin 17 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Human ITGA2B / Integrin Alpha-IIb Recombinant Protein
MBS2901878 Inquire

Human ITGA2B / Integrin Alpha-IIb Recombinant Protein

Sign In for Pricing
View Details
CD10 Antibody BIOTIN-Conjugated
MBS542199-01 0.1 mg

CD10 Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details