Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-12 (KV112)

This Recombinant Human Immunoglobulin kappa variable 1-12 (KV112) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-12 IGKV1-12

UniProt

A0A0C4DH73

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMMT Knockout Hela Polyclonal Cells
ARG37633 1 Million

IMMT Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Pim2 (pim-2 oncogene, pim-2h, proto-oncogene Pim-2 (serine threonine kinase), serine/threonine Protein kinase pim-2, serine/threonine-Protein kinase pim-2)
167473 100 µg

Pim2 (pim-2 oncogene, pim-2h, proto-oncogene Pim-2 (serine threonine kinase), serine/threonine Protein kinase pim-2, serine/threonine-Protein kinase pim-2)

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS505948 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
TATA binding protein TBP (9D1) Mouse mAb
MBS4753893-01 0.1 mL

TATA binding protein TBP (9D1) Mouse mAb

Sign In for Pricing
View Details
TATA binding protein TBP (9D1) Mouse mAb
MBS4753893-02 5x 0.1 mL

TATA binding protein TBP (9D1) Mouse mAb

Sign In for Pricing
View Details
Hemoglobin Ao protein (Glycated)
MBS537487-01 1 mg

Hemoglobin Ao protein (Glycated)

Sign In for Pricing
View Details